PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.2115s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 379aa    MW: 42308 Da    PI: 7.8013
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.2115s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.84.2e-5391441128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             lppGfrFhPtdeel+ +yL+kkv+++++++ ++i++vdiyk++PwdLp k++ +ekewyfFs+rd+ky++g r+nra++sgyWkatg
  SapurV1A.2115s0010.1.p   9 LPPGFRFHPTDEELILHYLRKKVASTPFPV-SIIADVDIYKFDPWDLPGKAALGEKEWYFFSPRDRKYPNGARPNRAAASGYWKATG 94 
                             79****************************.89***************888899********************************* PP

                     NAM  88 kdkevlsk.........kgelvglkktLvfykgrapkgektdWvmheyrl 128
                             +dk ++++         ++e+vg+kk Lvfy+g+ pkg+ktdW+mheyrl
  SapurV1A.2115s0010.1.p  95 TDKIIMASaitpggvieGHENVGVKKALVFYRGKPPKGVKTDWIMHEYRL 144
                             *******99999988887888***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-644176IPR003441NAC domain
PROSITE profilePS5100561.6379176IPR003441NAC domain
PfamPF023652.1E-2710144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MKNVQQSRLP PGFRFHPTDE ELILHYLRKK VASTPFPVSI IADVDIYKFD PWDLPGKAAL  60
GEKEWYFFSP RDRKYPNGAR PNRAAASGYW KATGTDKIIM ASAITPGGVI EGHENVGVKK  120
ALVFYRGKPP KGVKTDWIMH EYRLADTPTF SYIKPIKPKD SSMRLDDWVL CRIYKKAHSL  180
TSCARAEMSS EHEQEEEDEE QQLLAPEIPF PSLKSSPPMN NKCPLMSQKS CSFTNLLDAM  240
DYSLLSSFLA DTQFNPPGFE SNPAPGGGAA CQMEQPPFFC NSHIGGGGGG GGSSFFIQKL  300
PQLSTSVPGN MDNKLKRQLD EEMQQQQQQQ PSKKFMSSCS LTNTSNISTQ TDMNQYNFLS  360
QTFLNQQLLL SPHLQFQG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B3e-71417912168NAC domain-containing protein 19
4dul_A3e-71417912168NAC domain-containing protein 19
1ut7_B3e-71417912168NO APICAL MERISTEM PROTEIN
1ut7_A3e-71417912168NO APICAL MERISTEM PROTEIN
1ut4_B3e-71417912168NO APICAL MERISTEM PROTEIN
1ut4_A3e-71417912168NO APICAL MERISTEM PROTEIN
3swp_D5e-71417915171NAC domain-containing protein 19
3swp_C5e-71417915171NAC domain-containing protein 19
3swp_B5e-71417915171NAC domain-containing protein 19
3swp_A5e-71417915171NAC domain-containing protein 19
3swm_D5e-71417915171NAC domain-containing protein 19
3swm_C5e-71417915171NAC domain-containing protein 19
3swm_B5e-71417915171NAC domain-containing protein 19
3swm_A5e-71417915171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010999473.10.0PREDICTED: NAC transcription factor 29-like
SwissprotQ8H4S43e-85NAC10_ORYSJ; NAC transcription factor ONAC010
TrEMBLB9IPL80.0B9IPL8_POPTR; Uncharacterized protein
STRINGPOPTR_0019s04690.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66212750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.11e-110NAC domain containing protein 47